SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000063713 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000063713
Domain Number 1 Region: 215-382,681-901,954-988
Classification Level Classification E-value
Superfamily Ras GEF 4.71e-104
Family Ras GEF 0.00022
Further Details:      
 
Domain Number 2 Region: 363-448
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-20
Family PDZ domain 0.0048
Further Details:      
 
Domain Number 3 Region: 95-218
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000000114
Family cAMP-binding domain 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000063713
Domain Number - Region: 601-651
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0145
Family Ras-binding domain, RBD 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000063713   Gene: ENSDARG00000010945   Transcript: ENSDART00000063714
Sequence length 1334
Comment pep:known chromosome:Zv9:21:43769754:43800000:1 gene:ENSDARG00000010945 transcript:ENSDART00000063714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPGDLSKMHLTDHPHQQMHMANSQSGCSIASDSGSSSLSDIYQQATESELGDVDLSGLPE
APVDSEEEEEDEDMDRSSDALLARDLVRECLEKDALDRTDDDIEQLLEFMHQLPAFANMT
MSVRRELCRVMMFEVVEGEGTVILQDKQELDLWYVILNGAVEISYSDGRSEILCMGNSFG
ITPSLDRQLMSGAVSTRADDCQFVCIAQQDYCRILNHVEQNTHKVEEEGEIVMVKEHREL
DRSGTRKGHIVIKGTPERLVLHLVEEPSVVDPTYIEDFLLMYRTFLSSPMEVGNKLLEWF
RVDALRDTVVTRIVLLWVNNHFNDFEGDPVMTQFLEDFEKLLDASKMKGHLRLLNIACAA
KAKCRQVTLQKSCRESPLMFNLQGGSERGFGIFIESVEPNSRAAEAGLKRGDQVLEINGQ
NFENISYTKAMDILKNNTHLSLTVKTNIFVFKELQSRMRHEKKNGGPHIPKIQERKSNRF
SIPDLPGDMEFPTDSKSHKKMKANTVSGGRNKIRKMLEKTRFSILPPKPFSKLILSQSQD
DSIVGTKQCRHSVAIMPIPGSLSSSSPDLLQPAATVLDFSNPSDFISKQLERVFIPCPSS
DYIIISKDTTAKDVVSHVVSEFGLIAAAETYSLCEVSVSPEGVIKQRRLPDQLSKLADRI
QLNGRRYYLKNNMETETLCSDEDAQDLLRESQISLLQLSTVEVAAQLSMRDFSLFRNIES
TEYVDDLFKLDPGGGGGAGHLKQFEEIINQETFWVSTEILREPNAIKRMKTIKHFIKIAL
HCRECKNFNSMFAIISGLNLAPVARLRSTWEKLPSKYEKLFRDLQDIFDPSRNMAKYRNI
LSSQSVQPPIIPLFPVVKKDLTFLHEGNDSSVDGLVNFEKLRMIAKEIRHVVRMTSANMD
PALMFRQRKKRWKSLGSLSQGSTNSNLLDVQGNHKKRVRRSSLLNAKKLYEDAQMARKVK
QYLAHLEVETDEEKFQIMSLQCEAAYSTLSKNLSERRSTKSDMSPVSLRSGLSSSRTQNR
VSQVLQVPPVSLYPLRKKSIAKDLAATFSSPNSPQTLKKSAGAAEDSRRTEESLSTVSSL
HSSPTVSPQGSPRKGYALMPAGRSDLSDSSEISSRSSIVSNCSVDSGLTAAPASVPAETA
FVFKSKLSASIFDDFQHASYWSSSVRDSTVALSTVSNSAEELTAPEHSSVSEIADSGRAS
WTSCSSNSQVSMDSLQTVQRAPEPLSLRHTPMGGPIAEVDPALLEERDSEDGYDPVKHNS
TDPADGSDYKTITSSTEKGLIVYCVTSPCKDERFRAPPPTPPGYQGLTLGAAQAQDAQKL
KPPEYKVALQSCRL
Download sequence
Identical sequences ENSDARP00000063713 ENSDARP00000063713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]