SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000064016 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000064016
Domain Number 1 Region: 677-1073
Classification Level Classification E-value
Superfamily Ras GEF 1.57e-98
Family Ras GEF 0.0000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000064016   Gene: ENSDARG00000043593   Transcript: ENSDART00000064017
Sequence length 1085
Comment pep:known chromosome:Zv9:8:12292777:12361745:-1 gene:ENSDARG00000043593 transcript:ENSDART00000064017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGKIDSKQESQRSHLTSFTMKLKDKFHSPKIKRTPSNKKSKPPPEQPVKSPEKTVTKSL
SRLEEHEKEVVSALRYFKTIIDKMAVDKKVLEMLPGSASKVLEAVTGLVQLDSKILSSSR
VSSCLNRLYQSLANLIRWSDQVMLEGVNLEDKDTITTVTNVIKAVLDGVKELVKVAIEKQ
EHPSPTTPVKTIPPVASPQRVPEPPVIETKEPILNDSPAPAENIETPNDVPEEEVAPPKP
PLPGLKVPEQHCPPALPPKKRQSAPSPTRIAVVAPMSRTTSGSSLPIGICRQEYEADALQ
RRFSGGSHSYGGESPRLSPCGSIGILSKSDEQLSSLDQDSGQCSRNTSCETLDTAESYDP
DYDFLHQDLSSTEQIPHTHTGGCLSPLPESLHESSSFPVQHQSMPPALPKKERRPPLPPV
ERLYSQYDNVPDEDMHTPPFPLFGAIPPSNPGVFMGNFGPSENTQIPQSPPPLPEKKSRH
ILKYMQFMEDYSEPLPSVFYQTPQSESIYEQRNRKRFQEVYGLSDSFSSSDETLPPPALP
PKQRQLASSHSASPSSSSSSSLSCQLQQCVSGPGPGETESTLSLSASNSSLNREGSLPVP
TSESANDEGGEGEYVNLYSSNQANGDVTLSNGDSFCGAEDSPQDSAIEHSKDPADREGWK
QKCVDSDLTSEEVDELCLIDHDEIMSRITLKQENDDGPDVRAGSGDILLVHATETDRKDR
VLYCEAFLTTYRTFLTPEDLIKKLRYRYTRFSLSSDSIKQRASKNTFFVLVRVVDELCLV
ELTEDILKQLMELVFNLLCKGELTLARVLRKNILDKVQQKKLLQYTNSLKTLAARGVAAR
PGTLHDFRSHEIADQLTLLDAELFYKIEIPEVLLWAKEQNEEKSPNLTQFTEHFNNMSYW
VRSIIILQEKAQDREKLLLKFIKIMKHLRKLNNFNSYLAILSALDSAPIRRLEWQKQTSE
GLEEYCTLIDSSSSFRAYRAALADVEPPCIPYLGLILQDLTFVHLGNPDHIEGKINFSKR
WQQFNILDTMRRFQQVHYDLKHNDDIVSFFNDFSDHLAEEALWELSLKIKPRNITRRKTE
REEKT
Download sequence
Identical sequences XP_005166961.1.45394 ENSDARP00000064016 ENSDARP00000064016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]