SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000064967 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000064967
Domain Number 1 Region: 3-469
Classification Level Classification E-value
Superfamily Ras GEF 8.76e-111
Family Ras GEF 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000064967   Gene: ENSDARG00000044251   Transcript: ENSDART00000064968
Sequence length 475
Comment pep:known chromosome:Zv9:10:9249764:9275152:1 gene:ENSDARG00000044251 transcript:ENSDART00000064968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQTTPYSSKFNPSAYSSSHSHRQPVEENYGGLHYRDNKLVSGSLEALIQLLVPTVDYYP
DRSYIFTFLLSSRLFLNPFELMSRVCYLGVDHHRVGDPQMDKKRIRDIAPKIVQLLTEWT
ETFPYDFRDERMMRSLKEMTHRLAFGDELSRRAMQRLIQRLLRKLTTLGQYEESLATTSA
AAAIDRPVALKSKQQLVRRDDCVLNLCDDPFIFAQQLTHIEMERLSYIGPEEFVRAFAQK
RPSDNHKSFFSKRKASNLEAYVEWFNRLSYLTATEICMPVKKKHRARVLEFFIDVAQECF
NIGNFNSLMAIITGMNMNPVSRLKKTWGKVNTDKFDILVHQMDPSSNFYSYRTALRGATQ
RSSTAHTSQEMIVIPFFSLFIKDIYFLNEGCANRLSNGHINFEKFWELAKQVSEFLSWRQ
VICPFERDRKTLQYLISAPVFSEDELQLASYESEGPENNLERDTRRSLRSSLSRM
Download sequence
Identical sequences Q6DBW1
7955.ENSDARP00000064967 ENSDARP00000064967 NP_001003479.1.45394 ENSDARP00000064967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]