SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000066928 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000066928
Domain Number 1 Region: 801-887
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.32e-16
Family PHD domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000066928
Domain Number - Region: 14-70
Classification Level Classification E-value
Superfamily Histone-fold 0.009
Family Archaeal histone 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000066928   Gene: ENSDARG00000045513   Transcript: ENSDART00000066929
Sequence length 898
Comment pep:known chromosome:Zv9:4:24171361:24255591:-1 gene:ENSDARG00000045513 transcript:ENSDART00000066929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCESFARSLLRVSVAQMCQAVGWDAVQLSACDLLSDVLERYVQQLAKSCHRYSELYGRTD
PGLSDVDQAFGFLGVSIAELEDYVNNVEPIGYPQTIPQFPISKSSVLQFPAAGFDTDARD
ALRGERRDYIPEYFPPLVSLQEDEEEEEPVPADMGTSAEAMQVSMGEEEDGEEEENDENW
LSRHDGQSPRPEGLLPAAKRPRLSTKPGVSPEWSYEPREPLSSLNSQHMPHSPSPPLSPE
LPRPPVAPPTPGHKPKLPSPSPARQKNKSPKRGGAAPTGVLGRPLTLTPPKTNQKAGKRS
PGMPKSPRSPRPSSAPLGIAGRGWPGPLADDSSRDGQFKCNDTDDKDIENSIAAVIARAC
AGEDGTSDPFAYDSDSDSEGPHPPKPVPKHTLSHIKPPQALTSKHLLPPVPPLLNPPIRW
TMDDSIDEVIRKASQGQKPIQPPSLSPLEPPYLSSPSDSPPTPPPPLKLTQERKDSPTGN
LLKKKLKKDIKTKLKKKDKERLKEKGKEKGKNKEKNKEKKREKERGQVEENKMPWPELSL
VVGGEERRDGIGGKKEKDKHKDKKKDKEKGKKEKEKRDKGKERGKEEKRISQGTKDIAIA
VAGATSPLFSPQTCLRIPSMLPPLPPILPDKLFPHPKDIKSKDKDKKKDKKEKKKKKEKE
KDREKEREKEREKERTKEKERDKEEKKKDKEKKEKTKEKEKDKPKLEKTSLMAEIPPAVP
PSPVIPRLTLRVGAGQDKIVISKVVPDTEPTPPPPRTPVARMGPGARIRPPPVLPPPAPP
PATPPPRPPPVLPPPPPPAAPIQTPPNQAKARGCSVVTETVSAYVIRDEWGNQIWICPGC
NKADDGSPMIGCDECDDWYHWPCVGLLAAPPEDQSWFCIKCAGKKKDKKTKKRKRKAH
Download sequence
Identical sequences Q5RH27
ENSDARP00000066928 ENSDARP00000066928 7955.ENSDARP00000066928 NP_001036209.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]