SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000067948 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000067948
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily Histone-fold 1.77e-58
Family Nucleosome core histones 0.00000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000067948   Gene: ENSDARG00000051778   Transcript: ENSDART00000073457
Sequence length 124
Comment pep:known chromosome:Zv9:25:36167071:36167557:-1 gene:ENSDARG00000051778 transcript:ENSDART00000073457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPAKTAPKKGSKKAVTKTASKSGKKRRRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
Download sequence
Identical sequences B3DJF8
ENSDARP00000067948 ENSDARP00000067948 NP_001122231.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]