SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000070699 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000070699
Domain Number 1 Region: 57-129
Classification Level Classification E-value
Superfamily Histone-fold 1.93e-23
Family TBP-associated factors, TAFs 0.0000465
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000070699   Gene: ENSDARG00000054085   Transcript: ENSDART00000076222
Sequence length 162
Comment pep:known chromosome:Zv9:16:39234956:39241204:-1 gene:ENSDARG00000054085 transcript:ENSDART00000076222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQYPAQTSRSNFYTVVKAEASSTPPLSSSMANSTVAPGKLPGTPGPAGRLSPEGPQVLS
KKKLQDLVREIDPNEQLDEDVEEMLLQIADDFIESVVTAACQLARHRKSSTLEVKDVQLH
LERQWNMWIPGFGSDEIRPYKKACTTEAHKQRMALIRKTTKK
Download sequence
Identical sequences Q6P013
ENSDARP00000070699 ENSDARP00000104983 ENSDARP00000105820 ENSDARP00000127512 ENSDARP00000129047 gi|170284463|gb|AAI61006| gi|187607294|ref|NP_001120359| ENSDARP00000070699 NP_938182.1.45394 XP_009290705.1.45394 7955.ENSDARP00000070699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]