SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000077785 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000077785
Domain Number 1 Region: 621-685,901-1241
Classification Level Classification E-value
Superfamily Ras GEF 1.7e-118
Family Ras GEF 0.0000128
Further Details:      
 
Domain Number 2 Region: 221-443
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-43
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 3 Region: 20-128
Classification Level Classification E-value
Superfamily PH domain-like 3.27e-18
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 4 Region: 431-586
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000591
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000077785   Gene: ENSDARG00000002816   Transcript: ENSDART00000083350
Sequence length 1244
Comment pep:known chromosome:Zv9:5:53315188:53434604:1 gene:ENSDARG00000002816 transcript:ENSDART00000083350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSVRYNEGHALFLSVIARKEGTKRGYLSKKTTENSKWHEKFFALYQNVLFYFDTDQSA
RPSGIYLLEGCTCERVPALKVSTVGKDALDKLQYFLVVFGHDGQKPLELRTEEESDCDEW
VEAIQQASYSDIIIEREVLMQKYIHLVQIVETEKVAANQLRTQLEDQDTEIERLKAEIIA
LNKTKERMRPYHVFQEEEDPDIKKIKKVQSFMRGWLCRRKWKIIVQDYICSPHAESMRKR
NQIVFNMVEAETEYVHQLSILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHE
IFHQGLKARIANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLK
QYESNAACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSR
VMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLIQLPSVERGKLSKVRLGS
LSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKQGGVLSLIECTLIEEPDANDEDAKNSG
QVFGHLDFKIVVEPSDAPAFTVVLLAPSRQEKAAWTSDISQCIDNIRCNGLMTSVFEENS
KVTVPHMIKSDARLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNT
FLHTYRIFTTATVVMEKLADIYKKPFTSIPVRSLELFFATNQNNRSGDHVNDKSPRLCRK
FSSPPPLSISSRTSSPVRTRKLSLNSPIGSKVGILDLSTTSSSAASSPTSANPTISPPPS
NNNNNSKPPLDLSRGQSPSSPEQSPGALDDNAEVPRIDALCGKLRRSIRRAVLESVSLDK
FIPESPQASEPGEISPCRSPSTPRHLRYRQSGVQTAENSRCSVSPASAFAIATAAAGHSS
PPVFNNSERTCDKEFIIRRAATNRVLNVLRHWVSKHSQDFEMNGELKMGVICLLEEVLRD
PDLLPQERKATANILSALSQDDQDDAQLKIEDILQMAECPKAECFESLSAMEIAEQITLL
DHIVFRSIPYEEFLGQGWMKTDKTERTPYIMKTSQHFNDMSNLVASQIMSHTDVGSRAGS
IEKWVAVADICRCLNNYNGVLEITSALNRSAIYRLKKTWAKVCKQTKALMDKLQKTVSSE
GRFKNLRETLKNCNPPCVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHIIREIR
QFQQTPYRIEHQPKVTQYLLDKTLIMDEDTLYDLSLKIEPRLPA
Download sequence
Identical sequences A2CEA7
NP_001121705.1.45394 7955.ENSDARP00000077785 ENSDARP00000077785 ENSDARP00000077785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]