SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000079754 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000079754
Domain Number 1 Region: 565-1043
Classification Level Classification E-value
Superfamily Ras GEF 5.36e-136
Family Ras GEF 0.000000000000335
Further Details:      
 
Domain Number 2 Region: 11-176
Classification Level Classification E-value
Superfamily Histone-fold 2e-53
Family TBP-associated factors, TAFs 0.00000086
Further Details:      
 
Domain Number 3 Region: 208-397
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.24e-38
Family DBL homology domain (DH-domain) 0.000000238
Further Details:      
 
Domain Number 4 Region: 416-571
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-33
Family Pleckstrin-homology domain (PH domain) 0.00000926
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000079754   Gene: ENSDARG00000060506   Transcript: ENSDART00000085319
Sequence length 1345
Comment pep:known chromosome:Zv9:13:37042181:37065157:-1 gene:ENSDARG00000060506 transcript:ENSDART00000085319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAGMQHDFSSSEENSARWRGLFVQGLRKVQVQVHPNLSAKEDALQHIEALILQLLNKLCV
TQPRTIADVEDRVQKTFPNPIDKWAMGDAQNAIEKRKRRNPLLLPVDKIHPLLKEVLGYK
IDYNVCLYIVAVLEYISADILKLAGNYVSNIRHYEISQQDITVSMCADKVLMDMFDQEEE
MGLLSQSVEEVSSSGVLTYDDLVRLEIAEERQYLRELDLIIKVFRQAFMSNSKLFSAQDV
ELAFSNILEVQELTVKLLGLIEDAVEMTADGSPHPLVGSCFEDLAEEQAFDPYETLSQDI
LSKEFCQHFNTLMSRPTVALHFQSIAEGFKEAVQYVLPQLMMVPVYHCIHYFELLQQLQE
CSEEQDDRECLKQAQTALINLQCSIERIYAKHQPRRKQGEPLYRLYSRASRSKQAAIKRM
NDIQKSIDGWEGKDIGQCCSQFILEGALLRAGAKHERHNFLFDGLMISCKANQSSRLPGA
GSGAEFRLKEKFVLRKYRIVDREDSPEFRHAFELVGREESGAVFSARSAEEKSAWMAALV
TLQYRPTLDRMLDTVLHREEQAQPLRLPSPDVYRFAIQDSEENIVFEEGAQSKTGIPIIK
AGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQDLLTLLIERIEIPEPEPSEADREA
LWNGEQPMAAELQRFRREYVQPVQLRVLNVFRQWVEHHFYDFENDPELYERLEGYLISTT
QLRGKSMRKWVESISKIMRRKIQMQSNGISHNITFESPPPPIEWHISRPGQVDTFDLMTL
HPIEIARQLTLLESDLYRAVRPSELVGSVWTKEDKEKNSPNLLRMIRHTTNLTLWFEKCI
VEAENVDERVAVFSRIIEILQVFQELNNFNGVLEIVSAINSVPVYRLDHTFEAVPERKRR
ILEEAVELSQDHFKKYLAKLKSINPPCVPFFGIYLTNILKTEEGNPDFLKRDGKELINFS
KRRKVAEITGEIQQYQNQPYCLKVEHDIKRFFENLNPMGNMNEKDFSDYLFNKSLEIEPR
NSKQPPRFPRKTTYSLKSPGVRPVRQAVGGGGTLKGHPVPLEREPPHKITFRSIAETEPE
TPPSLPTSPNTPTPPQSASSDFNSVFEQDFMPYAGNNTIFAPVFLPQSKFQSVSCGSLHQ
LMSDEPLKPPPLPPRRKDTSSDKNSRSDSPPAIPPRLPPPPRLQPRVPVINGPTDGPLPS
PPPPLPRDPLPDTPPPVPQRPPEIFINYPVNMQPSPGGRFHWDFTTSPSTPNTPPGTPSP
RAVLPGTPSPRVPRRPCTPSVSQPILVHLPPPTPAPPIPPRHNSTSALPKLPPKTYKREL
SQSSHTLSQPSLHTLSLVDNRDSNE
Download sequence
Identical sequences ENSDARP00000079754 ENSDARP00000079754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]