SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000082104 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000082104
Domain Number 1 Region: 365-531,829-1047,1100-1135
Classification Level Classification E-value
Superfamily Ras GEF 7.06e-107
Family Ras GEF 0.00016
Further Details:      
 
Domain Number 2 Region: 513-596
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-16
Family PDZ domain 0.0048
Further Details:      
 
Domain Number 3 Region: 243-375
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000000576
Family cAMP-binding domain 0.001
Further Details:      
 
Domain Number 4 Region: 2-100
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000419
Family cAMP-binding domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000082104
Domain Number - Region: 739-818
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00134
Family Ras-binding domain, RBD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000082104   Gene: ENSDARG00000061459   Transcript: ENSDART00000087670
Sequence length 1525
Comment pep:known chromosome:Zv9:1:19924165:19961060:-1 gene:ENSDARG00000061459 transcript:ENSDART00000087670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDLQIVYSYLHGMEALSNLREHQLRLMCETVRYEQHDANEVLYYPDDIGTCWYILLSGSV
FIKESMFLPRSSFGKRSAGSLRRGCECIVLEASEMIVVDYMDDNDEYFQRQASHRQSRRR
FRKINQRGERQTIIDTVDNYPVSKPPLPPGYHSLPTDFSKLHPSDSCHSHMTSSQSRSSI
ASDSGSSSLSDIYQATESECGDMDLSGLPETAVDSDEDDDDEDVGRGTDHLMSRDIVRDC
LEKDPMDRTDDDIEQLLEFVQQLPAFASLSVSVRRELCAVMVFAVVERAGTIVLNHGEEL
DSWSVILNGAVEVIYLDGRSESVCMGGSFGVCPSMEKQLMTGVMRTKVDDCQFVCIAQQD
YCCILNQVEQNTQRVEEEGEIVMVKEHRELDRTGTRKGHIVVKGTAERLMQHLVEDHSIV
DPTYIEDFLLTYRTFLPSPLILGQRLLDWFNDPCLRDKVTRVVLLWVNNHFSDFEGDPDM
TSFLEEFQSNLEREKMTGQLRLLNIACAAKAKPRVITVTRTAREIPLPFTLIGGAERGTR
LFISSVEVGSKAEEAGLKRGDQILEVNGQTFENVQLSKATEILRNNIQLSMSVKTNLLVF
KELVARVAEERKNGVPHLPKIGDGKKNCRYSIPELGAGSDVIGQEKISKKAKAHTVGGRN
KLMKILDKTRMSILPQKPYSDLGLGQTQDDSIVGLRQNKQTPPTMPVSGTLSSSNPDLAQ
GQQRIIDYSTQPPELQDQVLRIFKADQQSRYLLANRDTTAREAANLAIKEFGLSASPEAF
SLCEVSVTQEGVIKQRRLPDQLSKLADRIQLSARYYLKSNMETETLCSDVEALEMQRESV
VPLLSLSSMEIANQLSARNYLLFSCIEPTDYINDLFKLHPQEPPTNLRNFEGLVNQETFW
VATEIVQETNLAKRVKIIKHFIKIALHCRDCKNFNSMFAIISGFNLAPVSRLRSTWERLP
GKYEKLLAELQDVFDPSRNMAKYRNLLNKHNLQPPVIPLFPVIKKDLTFLHEGNNSEVDG
LVNFEKLRMIAREIRHVVRMASITMDPALLFKTRKKKWRSLGSLSQVSSSSLSDIGTMGG
KRKGRRSSFLSAKKLYEVEMMSRRVRQYLDTHSNECNEDTLHELSMTCEPAKNNLSKNET
LKHAGERRRIDASPAGQRSASPQQTNGNHGRKKSISKELPFGKMFLCYSYKNLHTIRVFT
ASQRPLLARNFFVCVSLEGRDRQRKLPEDSQSSTSSLLSSPRNSPQSTPRKDNTMQLIST
YDFCPQLVVSEVSDQMSLLSSSSSELLMVDDHTHTQPHSLAHPLSARRAEPDQLSLGIHT
QIHNDAVAFSRPTTHSNPALESYSLTQDQCDRASLDAADSGRGSWTSCSSGSHDNIQSIP
QRVGYYDSRSWEMLSDGMGRSHMTTPTGYWADELEGDTGTIKRRGGKDETPNTNKNTVSR
REGHFREPPPTPPGYTAVSLAEADTNSHAHGRRPPDYSAALQRSRFLKRTCDPPPLHSSS
RLPPYSHCQTPRRSQADVYWNKPNK
Download sequence
Identical sequences ENSDARP00000082104 ENSDARP00000082104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]