SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000083259 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000083259
Domain Number 1 Region: 171-353
Classification Level Classification E-value
Superfamily Macro domain-like 1.36e-54
Family Macro domain 0.0000000347
Further Details:      
 
Domain Number 2 Region: 14-117
Classification Level Classification E-value
Superfamily Histone-fold 5.37e-37
Family Nucleosome core histones 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000083259   Gene: ENSDARG00000053442   Transcript: ENSDART00000088826
Sequence length 357
Comment pep:known chromosome:Zv9:21:44399254:44410211:1 gene:ENSDARG00000053442 transcript:ENSDART00000088826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRGGKKKVSRGSRSARAGVIFPVGRMLRFFRRGLPKYRISVGAPVYMAAVLEYLTAEI
LELAGNAARDNKKGRVTPRHILLAIANDEELHQLLRGVTISAGGVLPNIHPELLAKKRES
RGKLEAAVTAPPSRKTSKTAAVRKLHSQKPSTGKRQSAKASGGQSASAGGFTVLSSKSLF
LGQKLQVVQADIASIESEAVVHPTNSSFYMGGEVGSALEKIGGKELSDAVLELRKSNGPL
EVAGAAISSGFGLPAKFVIHCNSPAWGSDQCEEMLEKTVKNCLALADEQKLRSVAFPSIG
SGRNGFPKQKAAQLILKAISSYFVTTMSSSIKTVYFVLFDNESIGIYVQEMAKLDSK
Download sequence
Identical sequences Q1RLR9
7955.ENSDARP00000083259 NP_001035451.1.45394 XP_021324578.1.45394 ENSDARP00000083259 ENSDARP00000083259 ENSDARP00000110439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]