SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000084413 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000084413
Domain Number 1 Region: 9-410
Classification Level Classification E-value
Superfamily Ras GEF 1.44e-94
Family Ras GEF 0.00054
Further Details:      
 
Domain Number 2 Region: 405-489
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000212
Family Calmodulin-like 0.041
Further Details:      
 
Domain Number 3 Region: 469-540
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000299
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000084413   Gene: ENSDARG00000062328   Transcript: ENSDART00000089980
Sequence length 593
Comment pep:known chromosome:Zv9:21:27810282:27833993:-1 gene:ENSDARG00000062328 transcript:ENSDART00000089980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RMESVSWDQPASVVELVEACIKAFDNEGVLKDPSLVRMFLTMHPWYLSSSDLAKKLLQKS
QQQDCSANRQSQICHLVKYWISEFPAEFDLNPALAEQIRGLKERLEQNGDVRRSLLIDID
SIPSYEWRRQLDETVQKKRKTSLLFDHLDASTLAEHLTYMEYKSFCKILFQDYHSFVMHG
CTVDNPILERFITLFNSVSQWIQIMVLSKPTAQQRATVISEFIKVAERLLQLQNFNTLMA
VVGGLSNSSIARLKNTQALISSDTRKVFDGLVELVTSFGNYSRYRQRFSECSGFRFPILG
VHLKDLIAVHVALPDWIDPEKTRVNLTKTYQLYAILEELALIQSTPPNIEANTDLLNLLI
VSLDQYHSEDDIYQLSLQREPRSIKLSTSSSKSQSPLIEQWASSVKPKADPSIINKHIEK
MVESVFQNYDTDGDGYISQEEFEIIRSNFPYLGKFDELDQNQDCKISREEMIEYFTKASS
LQNCKMGFVHTFAETSSIKPSFCRHCSRLIWGFYNQRCKCKVCGVSCHKDCVSRLAIECR
KRTQSVSVYNDVSSKATRSFSFPPPQSTETIAESPVICTDPLQDQDEVFDVYL
Download sequence
Identical sequences ENSDARP00000084413 ENSDARP00000084413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]