SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000086175 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000086175
Domain Number 1 Region: 190-294
Classification Level Classification E-value
Superfamily Histone-fold 1.68e-25
Family Nucleosome core histones 0.0064
Further Details:      
 
Domain Number 2 Region: 487-661
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.05e-24
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 822-929
Classification Level Classification E-value
Superfamily POZ domain 5.97e-22
Family BTB/POZ domain 0.0039
Further Details:      
 
Domain Number 4 Region: 121-182
Classification Level Classification E-value
Superfamily Histone-fold 0.0000157
Family Nucleosome core histones 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000086175   Gene: ENSDARG00000063040   Transcript: ENSDART00000091742
Sequence length 1012
Comment pep:novel chromosome:Zv9:18:14542235:14687263:-1 gene:ENSDARG00000063040 transcript:ENSDART00000091742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRGKSVVRTLEDLTLDSGYGGAADSFRSSSLSLCCSEAHISYAHGGHCWNLTDSMRSR
HNSLDTVNTVLAEDGETLECSGHCAKLPELEDVPWSLGEVENALNKEEELRFGTVSADLL
ARLSALVSRALVRIAREAQRLSLRYGKCTKYEVQSAIKMILSWTISVNCIAASLSALSMY
NMSTEDKFSRGKSERCGLVFSVGKFFRWMVDSRVAVRVHEHAAIYLTGCMESLFREVFTR
VLNSSVVEKDNGIPKFTLESFEQALSNDSELYGLLLPYQHLTCGKNANGILNLPDSLSLH
RNQQCSSKAGDAYSQSEQRTIEQSLLATRVGSIAELSDLVSRAMHYLQPLSIKNHSNGTP
LPQKSSLVHWEPEALYTLCYFMHCPQMEWENPNVEPSKVTLQNERPFLVLPPLMEWIRVA
LAHAEHRRSFSVDSDDVRQAARLLLPGVDCEPRQLKTDDCFCVSRKLDAASTEAKFLQDL
GFRMLNCGRTDLVNQAINLLGPGGINSMSEQGMTPLMYACVRGDEAMVQMLLDAGADINS
EVPNTVQKFPSVFPETRQATPLTFAVLHQHIPVVQLLLDAGANVEGSLQDGMENYTETPL
QLASAAGNFELVSLLLERGADPMIGTMYRNGISTAPHGDMNSYSLAAAHGHRNVFCKLLS
QSEKGKADVLSLQEILAEGSDLEERNSLKMEATRTGKAKLKALREAMYHSSEHGYVDITL
DIRSLGVPWTLHTWLESLRTCFLQHRRPLIQGLLKEFSSIEEEEYTEELITHGLPLMFQI
LRASKNEVISQQLAVIFTQCYGPYPIPKLTEIKRKQTSRLDPHFLNNKEMSDVTFLVEGK
PFYAHKVLLFTASNRFKLLLANRPAAENTCIEISHVKYNVFQLVMQYLYCGGTDALHIRN
TEVMDLLSASKFFQLEALQRHCEIICAKNINTETCVEIYNHAKFLEAPELSAYIEGYFLK
NMAVLIELEPFKQLLYNTPVENCCPDVLHDLEKTLATRIRSIHLSSSKGSIV
Download sequence
Identical sequences F1QKI7
XP_003200483.1.45394 ENSDARP00000086175 ENSDARP00000086175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]