SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000086682 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000086682
Domain Number 1 Region: 191-295
Classification Level Classification E-value
Superfamily Histone-fold 6.7e-28
Family Nucleosome core histones 0.008
Further Details:      
 
Domain Number 2 Region: 491-664
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.52e-24
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 827-934
Classification Level Classification E-value
Superfamily POZ domain 7.07e-24
Family BTB/POZ domain 0.0047
Further Details:      
 
Domain Number 4 Region: 123-183
Classification Level Classification E-value
Superfamily Histone-fold 0.0000512
Family Nucleosome core histones 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000086682   Gene: ENSDARG00000063255   Transcript: ENSDART00000092250
Sequence length 1021
Comment pep:known chromosome:Zv9:4:10878302:11071928:-1 gene:ENSDARG00000063255 transcript:ENSDART00000092250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGKGKTAARTLEDLTLDSGYGGAADSFRSSSVSLCCSDTHLSYAHGGNCWHLTESMHSR
HNSLDTVNTVLAEDTEILECSGQCAKLPELEEDVPWSLGEVEGALRKDEELCVGNASREI
LAKLSALVSRALVRIAREAQRMSLRYARCTKHEIQSAIKMVLSWTISVNCITAALSALSL
YNMSTGDKFSRGKSTRCGLIFSVGKFFRWMVDSRVALRIHEHAAIYLSACMESLFREVFT
RVQRSALVEKENGVPKFSVESLEQAINNDSELWGLLQPYQHLICGKNASGVLSLPDSLNL
HRDQQRAGKTGEGHAYSQAELRTIEQSLLATRVGSIAELSDLVSRAMHHLQPLHIKNPSN
GTPVHQNRTGSVHWEPEALYTLCYFMHCPQMEWENPNVEPSKITLHTERPFLVLPPLMEW
IRVAVAHTEHRRSFSVDSDDVRQAARLLLPGVDCEPRQLKADDCFCATRKLDAASTEAKF
LQDLGFRMLNCGRTDLVKQAVNLLGPDGINSMSEQGMTPLMYSCVRGDEAMVQMLLDAGA
DINSEVPSSLHKHPSVYPDTRQGTPLTFAVLHGHVPVVQLLLDARANVEGAIQESTENYT
ETPLQLASAAGNFELVSLLLERGADPLIGTTYRNGISSGPLGEMNSYSLAAAHGHRNVFR
KLLSQVEKDKGDVLSLEEMLAEGSEAVERRAPQNEGTLRTGKAKLRALREAMYHSAEHGH
VDITIDIRSLGVPWTLHTWLESLRTCFVQQRRPLIQGLLKDFSCIKEDEYTEELITHGLP
LMFQILRASKNEVISQQLSVIFTQCYGPFPIPKLTEIKKKQTSRLDPHFLNNKEMSDVTF
LVEGKPFYAHKVLLFTASPRFKSLLSNRPAAENTCIEISHVKYNIFQLVMQYLYCGGTES
LHIRNTEIMELLSAAKFFQLDALQRHCEIICSKNITNDSCVDIYKHARFLGALELAGFIE
GFFLKNMVLLIELENFKQLLYEVPADSPGPGPSYDVLHDLEQTLALRIRSIHLSTSKGSI
V
Download sequence
Identical sequences Q1LVW0
NP_001314771.1.45394 ENSDARP00000086682 ENSDARP00000086682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]