SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000089610 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000089610
Domain Number 1 Region: 36-298
Classification Level Classification E-value
Superfamily Ras GEF 5.49e-74
Family Ras GEF 0.0000327
Further Details:      
 
Domain Number 2 Region: 451-573
Classification Level Classification E-value
Superfamily PH domain-like 7.67e-20
Family Pleckstrin-homology domain (PH domain) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000089610   Gene: ENSDARG00000068370   Transcript: ENSDART00000098840
Sequence length 581
Comment pep:known chromosome:Zv9:8:33762668:33962244:-1 gene:ENSDARG00000068370 transcript:ENSDART00000098840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRRNGLPASVSITSRNTQDSSSSESLDGRSLDSAKSFDAVVFDMLKVTPEEFASQITLM
DAPVFKAIQPEELASCGWNKKEKHSLSPNVVAFTRRFNQVSFWAVREILTAQTLKIRAEI
LGHFIKIAKKLLELNNLHSLVSVVSALQSAPIFRLSKTWALISRKDKATFEKLDFLTSKE
ENYNRMREYTRSLKMAPCIPYLGIYLFDMTYIDSAYPASDSIIETEQRTNQMNNLLRIIS
DLQVSCKYDHLITLPHVQKYLMSVRYIEELQKFVEDDNYSLSLKIEPGNSSPRLVSSKED
LGGPSEVSMSVRYNRRPTCPDTSVVAHLPTPPPARHRKSHSLGNNMMCQFGVVESKSATF
PEKEKARHLLDDSFLESHSPVRNHTHDSVFTNGISLGSRESSFSDELSSTVERGRMYATL
GPNWRVPICNSPRSRSYIYSTPGAVSSYECSTLSSITIEGPLRRKTLMKEGKKPTLSSWK
RYWIVLSGSILIYFGSKALRANERRHYKSRPCKKITLTGWMVVLPDNPEHPNIFQLTDPD
RGNVYKFQTGSRFSAIIWHRHLAEACRSTRPQMPANLMSFE
Download sequence
Identical sequences B0UXH6
ENSDARP00000089610 ENSDARP00000089610 7955.ENSDARP00000089610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]