SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000093483 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000093483
Domain Number 1 Region: 9-95
Classification Level Classification E-value
Superfamily Histone-fold 4.64e-25
Family TBP-associated factors, TAFs 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000093483   Gene: ENSDARG00000070151   Transcript: ENSDART00000102708
Sequence length 95
Comment pep:known chromosome:Zv9:19:43622692:43628653:1 gene:ENSDARG00000070151 transcript:ENSDART00000102708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSADSFGAGGSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMIS
AEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQ
Download sequence
Identical sequences Q1L940
7955.ENSDARP00000093483 ENSDARP00000093483 ENSDARP00000093483 ENSDARP00000126159 ENSDARP00000126166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]