SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000093780 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000093780
Domain Number 1 Region: 4-125
Classification Level Classification E-value
Superfamily Histone-fold 1.5e-48
Family Nucleosome core histones 0.00000373
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000093780   Gene: ENSDARG00000070280   Transcript: ENSDART00000103006
Sequence length 128
Comment pep:known chromosome:Zv9:25:37385036:37385647:1 gene:ENSDARG00000070280 transcript:ENSDART00000103006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TEKAAKGK
Download sequence
Identical sequences Q561S9
ENSDARP00000067891 ENSDARP00000067945 ENSDARP00000093780 ENSDARP00000103318 ENSDARP00000107234 7955.ENSDARP00000067891 7955.ENSDARP00000067945 7955.ENSDARP00000088586 7955.ENSDARP00000093747 7955.ENSDARP00000093780 7955.ENSDARP00000103318 NP_001096634.1.45394 XP_001338956.1.45394 XP_005163251.1.45394 XP_009296457.1.45394 XP_009296458.1.45394 XP_009296465.1.45394 ENSDARP00000067891 ENSDARP00000067945 ENSDARP00000093780 ENSDARP00000103318 ENSDARP00000107234 ENSDARP00000129283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]