SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000094265 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000094265
Domain Number 1 Region: 10-81
Classification Level Classification E-value
Superfamily Histone-fold 0.0000000000000568
Family Archaeal histone 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000094265   Gene: ENSDARG00000070485   Transcript: ENSDART00000103489
Sequence length 127
Comment pep:known chromosome:Zv9:6:45871908:45874184:1 gene:ENSDARG00000070485 transcript:ENSDART00000103489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDEAQNQRLKAAVHYTVGSLCQHIAEDCEKQITKQTIAAIAETAFRQCDIFAKDLEAF
ARHAKRNTVTVDDVKLTARRTTALYNYIQQKSEELALNNQELKEKRKKNAAKRKSKDMEA
EENDVED
Download sequence
Identical sequences B3DJV8
ENSDARP00000094265 NP_001122221.1.45394 7955.ENSDARP00000094265 ENSDARP00000094265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]