SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000095109 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000095109
Domain Number 1 Region: 32-74
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000013
Family TBP-associated factors, TAFs 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000095109   Gene: ENSDARG00000070834   Transcript: ENSDART00000104334
Sequence length 124
Comment pep:known chromosome:Zv9:23:20717389:20718291:-1 gene:ENSDARG00000070834 transcript:ENSDART00000104334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEEDDPGFDEDLDDGGNGADSGQGRRKRLFSKELRCMMYGFGDDQNPYTESVDILEDL
VIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKKARKAFDEA
NYGS
Download sequence
Identical sequences F1QBH2
ENSDARP00000095109 ENSDARP00000095109 7955.ENSDARP00000095109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]