SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000098102 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000098102
Domain Number 1 Region: 9-74
Classification Level Classification E-value
Superfamily Histone-fold 2.33e-19
Family TBP-associated factors, TAFs 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000098102   Gene: ENSDARG00000077870   Transcript: ENSDART00000111885
Sequence length 248
Comment pep:known chromosome:Zv9:21:37684305:37690900:-1 gene:ENSDARG00000077870 transcript:ENSDART00000111885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPKTVPKDAQVMMQILKDMGITEYEPRVVNQMLEFTYRYVTTIIEDAKIYSAHAKKSS
VDADDIRLAIQCRVDQSFTSPPPRDFLLDIARQKNQTPLPLIKPYTGPRLPPDRYCLTAP
NYRLKSLQKKVSSSAGRITVPRLSVGAVSSRPSTPTLGTPSVQTVGTKVGTPVSLTGQRF
TVQIPSSQTASVKSATPTTPTVQNVLINPSLIGSKNILITTNMVSQNSSSESTSLKRKHE
DEDDYDAL
Download sequence
Identical sequences F1QDT4
NP_001037860.2.45394 7955.ENSDARP00000080102 7955.ENSDARP00000098102 ENSDARP00000098102 ENSDARP00000098102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]