SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000098342 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000098342
Domain Number 1 Region: 41-154
Classification Level Classification E-value
Superfamily Histone-fold 1.49e-57
Family Nucleosome core histones 0.00000537
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000098342   Gene: ENSDARG00000074491   Transcript: ENSDART00000114942
Sequence length 154
Comment pep:known chromosome:Zv9:7:76814613:76821072:-1 gene:ENSDARG00000074491 transcript:ENSDART00000114942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLSCNIILKYKFFNTIKFTSSDRCSSILVTTSICVKILKKKKKKKSKTAGKGGKKRKR
TRKESYAIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITS
REIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
Download sequence
Identical sequences ENSDARP00000098342 ENSDARP00000098342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]