SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000098662 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000098662
Domain Number 1 Region: 321-498,606-822,853-884
Classification Level Classification E-value
Superfamily Ras GEF 2.88e-103
Family Ras GEF 0.00018
Further Details:      
 
Domain Number 2 Region: 71-202
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.16e-33
Family DEP domain 0.0000239
Further Details:      
 
Domain Number 3 Region: 196-324
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.86e-26
Family cAMP-binding domain 0.00000298
Further Details:      
 
Domain Number 4 Region: 518-613
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.44e-25
Family Ras-binding domain, RBD 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000098662   Gene: ENSDARG00000079291   Transcript: ENSDART00000114423
Sequence length 885
Comment pep:known chromosome:Zv9:23:33588106:33657726:1 gene:ENSDARG00000079291 transcript:ENSDART00000114423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEIHARMFSFFKQILSAKKKNRLESPAVMCSADTLLRSTLRSSLQKTPLPDAVDTQDTI
KQFLSDRILKAARVVYSTLMEGNPGLIRDRKHHLKTYRQCCSGKELVDWLMKLNDCFQSR
SQAVGMWQVLVDEGILGHVKQELNFHDKDTQFYRFMEAEFDLNHTTNEKDSKDDELQESL
SLLIQMGPDALLTMILRKCPSQRTPEDLEVIYEELLHVKAVAHLSTSVRKELASVLVFES
HAKAGTVLFSQGDKGTSWYIIWRGSVNVITHGKGLVTTLHEGDDFGQLALVNDAPRAATI
ILREDNCHFLRVDKQDFIRILKDVEANTVRLEEHGKVVLVLEKSSAQDTPSCNKYTVMSG
TPEKILEHMLEAIKLETNGADFIDPCVTDFLLTHPVFMPCSQLCAALQHHYQAEPSEGSD
LEKAAYALNTKQKVVKLVCHWVALFALLLRDDPVASEFLEKFREGVMADSRLSSMLREQL
RDRRKTKIMENGCHTLTKLNQKFDWFSAYEEPVGKLRSIKAQDKVLYEIFKPDHKAVTVM
LPVDASVNDILTTLVDPDRNYVLVKMNSSGDRVQLKLETTAVSASLGVNEKLFLCTSSQV
EQLTPDKEQLGPEKSTMDTLEQICSKDMASQHTSYDWELFMAMHEVELVYYVFGREKFPG
STTANLERFVRRFNEVQYWVVTELCLCEDLGKRAILLKKFIKMAVVLKEQKNLNSFFAVM
FGLSNSAVQRLNKTWERLPNKTKRIYCAYERLMDPSRNHRAYRLTIAKLSPPYIPFMPLL
LKDMTFIHEGNKNYTDKLVNFEKMRMIARTVKTVRDCRSQPYVPSSPQKGLTERMFLDAQ
AIRISTYSDQSLNLRSATSIRQYIQNLKVIDNQKKLTQLSRALER
Download sequence
Identical sequences ENSDARP00000098662 ENSDARP00000098662 XP_005162410.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]