SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000099813 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000099813
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily Histone-fold 2.9e-58
Family Nucleosome core histones 0.00000307
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000099813   Gene: ENSDARG00000089039   Transcript: ENSDART00000109751
Sequence length 124
Comment pep:known chromosome:Zv9:25:36196984:36197569:-1 gene:ENSDARG00000089039 transcript:ENSDART00000109751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPAKAAPKKGSKKAVTKTAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
Download sequence
Identical sequences G1K2V1
ENSDARP00000099813 ENSDARP00000099813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]