SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000100132 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000100132
Domain Number 1 Region: 339-507,606-859
Classification Level Classification E-value
Superfamily Ras GEF 4.97e-98
Family Ras GEF 0.00032
Further Details:      
 
Domain Number 2 Region: 515-616
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.25e-30
Family Ras-binding domain, RBD 0.00048
Further Details:      
 
Domain Number 3 Region: 71-188
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.9e-26
Family DEP domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000100132   Gene: ENSDARG00000074307   Transcript: ENSDART00000114954
Sequence length 860
Comment pep:known chromosome:Zv9:16:20986985:21109404:1 gene:ENSDARG00000074307 transcript:ENSDART00000114954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELVNESPSFKDLVCKVLEVHKSRTDPPRLLKNGSQFKKNLEVIISQKPPPDSILCSNAG
QTRHQACVNNVPCAGQALRNAVLSNCQDNWKTHVKLAKIIRRTYIGIELVEWLMDHCEFI
QNREIASKIWNVLLDLGILLSVEQNNIFEDSRSLYQFTFKECEAQSCDFRNQVNWRSAVH
LLLQLVPHEQLCGGTQRRCKEDKQKTPDACNPVLQMRALEHFTSTVQNELLAALARKAQT
KSMEEDSNPQHNTDTPGSSSTPAVLKQVPGAGTRDREEISRLEMVQRLAKDGCRLLHSPL
RVNERPAEPLGDAAVRVCERSHEVLLPKRTTSLKSPSSSSSSWSRRYAAVPASPEKVLEH
VLGQLRLDEEQKSLQSRETDSLLDDFLLTYPVFMSTSDLCQALLGHYCSKKGRMKEEWRE
SLLRKRKVLHLLSQWSSLCTELPQDDDNTKLFLKTLYRHVLDDLYEFPPLEKDLKELQKL
LRMQRRHTVDEYSPQRKNKALFHQLSLKESWHPMRGPERERKEVLCRVYVTVDSYVSVRT
HSEVCVQELLRAVAERLDCAEDDMVLMALTYPGEKVVLELDQCVFSSSLSAAERLHVFRR
DLTEIMSPFTDNGQQCSGKMLSMNTWDVSVSLTNCDWSLFSNIHEQELVYFTLSRDSSSG
HTVALEQLLQRCNETQQWVMTEVLLCSTLCKRVQLFKKFIKIAAHCKAQRNLNSLFAIIL
GLNSPAVSRLTQTWEKVPGKFRKLFSELESLTDPSLNHKAYRDAFRKMKSPKIPFLPLLL
KDITFIHEGNKTFLDNLVNFDKLHMIADTVRIIRQCRTDHMGNLLFQKDSMEVRTYINYL
HLIDNQQTLFELSHRLEPKT
Download sequence
Identical sequences E7FFI6
ENSDARP00000100132 ENSDARP00000100132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]