SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000101181 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000101181
Domain Number 1 Region: 8-412
Classification Level Classification E-value
Superfamily Ras GEF 1.57e-96
Family Ras GEF 0.00056
Further Details:      
 
Domain Number 2 Region: 485-544
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.39e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0009
Further Details:      
 
Domain Number 3 Region: 418-481
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000145
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000101181   Gene: ENSDARG00000077864   Transcript: ENSDART00000114212
Sequence length 708
Comment pep:known chromosome:Zv9:17:22976803:23031061:1 gene:ENSDARG00000077864 transcript:ENSDART00000114212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSFTLGKAASLELLLDACIHAFDDKGELHENQLPRTFLLMHRWYVSSTELAGKLLIMYR
DCRGDDCQRTRLKICYLMRYWIAEFPAEFDLDLGLIRLTEEFRDAAAELGGDKHIKLLDI
STIPSYDWMRKLTQRKKQVKKGKASLLFDHLEPIELAEHLTFLEYKSIRRISFTDYQSYV
IHGCLVDNPTLERSIALFNGISQWVQLMVLSKLTPQHRAEVITKYIHVAQKLLHLQNFNT
LMAVVGGLSHSSISRLKETHSHLSPEVTKIWNEMTELVSSNGNYCAYRKAFGESKGFKIP
ILGVHLKDLIAVHVVFADWVEDGKVNIAKMQQLFLTFNELVSLQSAVAQVEPNMDLIYLL
NLSLDLYYTEDEIYELSLLREPRNPKSQPTSPTTPNKPLAPLDWASGVTTKPDPSVVNKH
IRKVVDSVFRNYDHDHDGYISQEDFESIAANFPFLDSFCVLDKDQDGLISKDEMMAYFLR
ANPLLQCKMGPGFIHNFQEMTYLKPTFCEHCAGFLWGIIKQGYKCKDCGVNCHKQCRELL
VLACRRLPRSTSLGSVSPGVLTHSSLPSSPNLPTCKDDDEVFTFPTVSPSSGSDLEGKSI
TLMTGSAQRISVRLQRATTSQATQTEEHLWPENGWAAVADSGSHTFPKMRYRPHHKASKS
KGFARWENDTQGSMGTRNSRNSQEHSEESQQNGLTEQHTNKTRTSEIS
Download sequence
Identical sequences F1QFI3
7955.ENSDARP00000101181 ENSDARP00000101181 ENSDARP00000101181 ENSDARP00000111159 XP_005158574.1.45394 XP_005158575.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]