SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000102682 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000102682
Domain Number 1 Region: 4-127
Classification Level Classification E-value
Superfamily Histone-fold 2.84e-48
Family Nucleosome core histones 0.00000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000102682   Gene: ENSDARG00000088686   Transcript: ENSDART00000110632
Sequence length 128
Comment pep:known chromosome:Zv9:7:6748075:6748866:1 gene:ENSDARG00000088686 transcript:ENSDART00000110632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TEKAAKNK
Download sequence
Identical sequences E7F7N9
ENSDARP00000102682 ENSDARP00000102682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]