SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000103208 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000103208
Domain Number 1 Region: 6-124
Classification Level Classification E-value
Superfamily Histone-fold 5.97e-59
Family Nucleosome core histones 0.00000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000103208   Gene: ENSDARG00000075216   Transcript: ENSDART00000113626
Sequence length 133
Comment pep:known chromosome:Zv9:7:6754502:6755146:1 gene:ENSDARG00000075216 transcript:ENSDART00000113626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPAKPAPKKGSKKAVTKTAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSKNYSLYTIIL
Download sequence
Identical sequences 7955.ENSDARP00000103208 ENSDARP00000103208 ENSDARP00000103208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]