SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000103378 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000103378
Domain Number 1 Region: 15-53,154-407
Classification Level Classification E-value
Superfamily Ras GEF 1.18e-84
Family Ras GEF 0.00032
Further Details:      
 
Domain Number 2 Region: 62-163
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.87e-31
Family Ras-binding domain, RBD 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000103378   Gene: ENSDARG00000075271   Transcript: ENSDART00000112414
Sequence length 408
Comment pep:known chromosome:Zv9:19:3237686:3265667:1 gene:ENSDARG00000075271 transcript:ENSDART00000112414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLYRYVLEDVYEFPTLEKDLKEFQKLLRRRHTVDDYSPHQKNKALYQQLSLKENSVSL
RASPVESRDVMCRVYVSCDSYLSMRVKPAVVAQELLHIVSQRMDRCEDDMMLLAQTYSGE
KRVLQPHDSIYSESLVAPGRLIACRRDLSEILPPLTECPDLGQKPVRLLGINTWDVAVAL
TNFDWNLFNSIHEQELIFYTFSRQASSGHTVALEFLLQRCNEVQQWVMSEVLLCPSLSKR
VQLLKKFIKIAAHCKAQRNLNSSFAIIMGLNTAAVSRLNQTWEKVPGKFKKLFSELELLT
DPSMNHKAYRDAFKKMKPPKIPFMPLLLKDITFIHEGNKTFHDNLVNFEKLHMIADTVRL
IRHCQMDQTGNELSAVDSAEVRSSVHYLHIIDNQQTLFELSHRLEPRV
Download sequence
Identical sequences ENSDARP00000103378 ENSDARP00000103378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]