SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000103571 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000103571
Domain Number 1 Region: 619-687,917-1254
Classification Level Classification E-value
Superfamily Ras GEF 8.63e-119
Family Ras GEF 0.0000119
Further Details:      
 
Domain Number 2 Region: 222-444
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-44
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 3 Region: 23-128
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-19
Family Pleckstrin-homology domain (PH domain) 0.009
Further Details:      
 
Domain Number 4 Region: 432-588
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000201
Family Pleckstrin-homology domain (PH domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000103571   Gene: ENSDARG00000073824   Transcript: ENSDART00000109257
Sequence length 1256
Comment pep:novel chromosome:Zv9:18:26124358:26205126:1 gene:ENSDARG00000073824 transcript:ENSDART00000109257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGIRLNDGHVTYLGLLAKKDGTRRGCLSKKSSDNTKWHTKWFALLQNMLFYFESESSS
RPSGLYLLEGCVCDRSPSPKPSLSAKECLEKQYYFTVSFNHENQKALELRTEDVKDCDEW
VAAISHASYRNLATEHETLMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKSEIAA
MLKDNEKIQSSPTTAPSDDDSEIKKIKKVQSFLRGWMCRRKWKTIIQDYIRSPHAESMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIVEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVVSLIDCTLIEEPEGTDDESKSEK
SGQDMEHLDFKIVVEPKDSQSFTFILVASSRQEKSAWTSDISQCIDNIRCNGLMMNAFEE
NSKVTVPQMIKSDASLYCDDVDIRFSKMMNSCKVLQIRYASVERLLERLTDLRFLSIDFL
NTFLHSYRVFTSADVVLDKLITIYKRPISAIPARSLELFFASSQNNKLLYGEPPKSPRAS
RKFSSPPPLAITKTSSPNRRRKLSLNIPIITGGKALDLAALSCSSNGYASMYSTMSPFSK
TTLDINKLYVSSPITSKIPDEGEGKTDKADEISLCKQDNSVREESDNDQIQSDEAEAEVS
PTKSPTTPKNVKCKNSSEFSLFSYNNGMVMSSCRELDNNRSALSAASAFAIATAGANEGT
PTKEKYRRMSLASTGFPTDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFETNTELKM
KVISFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQICLEEVLQMAEGGKSESFENH
SALEIAEQLTLLDHLVFKVIPYEEFFGQGWMKNDKNEKTPYIMKTTKHFNDISDLIATEI
LRCEDVNVRVAVMEKWVAVADICRCLHNYNAVLEITSSLNRSSIFRLKKTWLKVSKQTKT
VIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTEDNLVNFSK
MRMISHIIREIRQFQQTAYKIDYQPKAALYLLDRSAVMEEEGLYEASLRIEPKVPN
Download sequence
Identical sequences E7F7V2
ENSDARP00000103571 ENSDARP00000103571 XP_002665395.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]