SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000103576 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000103576
Domain Number 1 Region: 4-125
Classification Level Classification E-value
Superfamily Histone-fold 4.94e-48
Family Nucleosome core histones 0.00000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000103576   Gene: ENSDARG00000076507   Transcript: ENSDART00000115109
Sequence length 127
Comment pep:known chromosome:Zv9:7:6819342:6819725:1 gene:ENSDARG00000076507 transcript:ENSDART00000115109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TEKAAKK
Download sequence
Identical sequences F1QTL1
NP_001136058.2.45394 XP_001335390.1.45394 XP_001337024.1.45394 XP_001920286.4.45394 XP_009301187.1.45394 ENSDARP00000103576 7955.ENSDARP00000102682 7955.ENSDARP00000103576 7955.ENSDARP00000103981 ENSDARP00000103576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]