SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000104233 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000104233
Domain Number 1 Region: 546-581,609-850
Classification Level Classification E-value
Superfamily Ras GEF 7.45e-33
Family Ras GEF 0.0066
Further Details:      
 
Domain Number 2 Region: 217-329
Classification Level Classification E-value
Superfamily SH2 domain 7.4e-25
Family SH2 domain 0.00064
Further Details:      
 
Domain Number 3 Region: 5-65
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000262
Family SAM (sterile alpha motif) domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000104233   Gene: ENSDARG00000016981   Transcript: ENSDART00000110550
Sequence length 912
Comment pep:known chromosome:Zv9:8:15600633:15728076:-1 gene:ENSDARG00000016981 transcript:ENSDART00000110550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKHMSISKWLSQLGLPQYCILFDEEYDGVEDLLHLTEMDLLGLGVQSRLHRIHILSSIQV
LRERETKRELRMMAEGRFSSLPRNMHVGRQCPLASSMDLLSSRPELSEMPVSGYQGISIH
GTLPRKKKTTTGSPVKQWEVNGNVGSLAAPYPGRHRLPPSPLIHNIIEEHQTFCSDRKQS
RNSAGMDPTMEYVKFSRDKYILDGPPEKLRRELEEELKLSSEEPRSHAWYHGAIPRQVAE
NLVQRDGDFLIRDSLSSPGNYVLTCQWKNSPQHFKINKRVVAMNEAYSRVQYLFEKEGFD
SIPALVRYYVGNREPVSEVIGAIIFQPINRALPLRCLEEKYGVGSIRVEAGYLERKSLTS
KRLSLNIMNGHGQDHTLSRGNLLSNKDKCGSQPACLNHVQERRRPLKTHQSESFLPIGSR
PQAQVQHMEHQPCPKSPVFRTGSEPALSPTVPRRMAFDTLPGEAIRGSDSQLCPKPPPKP
SKVPTVRVPCIPALKTLVVPPVPPVKPHKHRPSLQQQQSGSPEMSYCELSPCSPADWEKM
NSLQANGYVERLKTDGSIKLDRSSYHNAIEALDNDSEEDTEEDADKEQNGKKAFQKPVFE
TESAFRPANVNFRLLPKENKPLEMTVLKKAKELLVSQDPKTIAKHILQADCQVARILNVS
EEVKGQMGVSSGLELVTLPHGRQLRLDLIERHNTMAIGVAVDILGCTGSLEERAATLNRI
ILVALELKDSMGDLYAFSSIMKALDMPQITRLDHTWTSLRRKYTQTAIIYEKSLKPFYKG
LYEGGAEIPLSNASVPLLMPLLTLMERPAVTFEGMDVWENTDQGCEIMFRHLEGARAVAR
NADTYTCNAQRILQDFQPHEDMLEILRTDFQLRLLWGSRGAAVEQTERYDKFKLILTALS
RKLEPAVKHTEL
Download sequence
Identical sequences F1R3Z4
ENSDARP00000104233 ENSDARP00000104233 XP_005166943.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]