SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000104399 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000104399
Domain Number 1 Region: 4-124
Classification Level Classification E-value
Superfamily Histone-fold 1.24e-47
Family Nucleosome core histones 0.00000333
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000104399   Gene: ENSDARG00000074937   Transcript: ENSDART00000114908
Sequence length 128
Comment pep:known chromosome:Zv9:25:36213143:36213529:-1 gene:ENSDARG00000074937 transcript:ENSDART00000114908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKTGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TEKATKGK
Download sequence
Identical sequences E7EZX1
XP_005163276.1.45394 ENSDARP00000104399 ENSDARP00000104399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]