SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000105141 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000105141
Domain Number 1 Region: 7-365
Classification Level Classification E-value
Superfamily Ras GEF 4.32e-83
Family Ras GEF 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000105141   Gene: ENSDARG00000087154   Transcript: ENSDART00000123272
Sequence length 372
Comment pep:known chromosome:Zv9:7:74796351:74808800:-1 gene:ENSDARG00000087154 transcript:ENSDART00000123272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPLPVDSGTVDELVDICVQSFDDAGAVKDPSFVRMFLMMHPWYISSTDLSKKLLLKSQE
GSDDELRAKICHLVKFWISEFPAEFDLNPALADQIKDLRDNLNTGGNETPSQLIDVESVP
SYKWKRQVTKRVPSMSKRRKMSLLFDHLDPYELAEHLTYLEYKSFCKILFQDYHSFVMHG
CTVDNPILERFITLFNSVSQWIQLMVLSKPTAPQRAAVIAHFIQVAEKLLQLQNFNTLMA
VVGGLSNSSISRLKETQANISSDTNKVFNSLLDMLTSSGNYSQYRRRFAECTGFRFPILA
VSLKDLIAVHVALSDWTDAQKTQVNLTKTQQLYAILQELSLVQSNPPHIEANTDLLNLLT
VSVSVCGPAEKS
Download sequence
Identical sequences ENSDARP00000105141 ENSDARP00000105141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]