SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000105220 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000105220
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily Histone-fold 7.38e-57
Family Nucleosome core histones 0.000000624
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000105220   Gene: ENSDARG00000091770   Transcript: ENSDART00000123081
Sequence length 136
Comment pep:known chromosome:Zv9:7:76819046:76819456:1 gene:ENSDARG00000091770 transcript:ENSDART00000123081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQESSEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
Download sequence
Identical sequences A0A0F8AE53 A8KBJ5 G3N8L5 H2T664
ENSDARP00000067896 ENSDARP00000093781 ENSDARP00000093790 ENSDARP00000099321 ENSDARP00000105220 ENSDARP00000107737 ENSDARP00000111851 ENSDARP00000126796 ENSTRUP00000020153 ENSTRUP00000020153 31033.ENSTRUP00000020153 69293.ENSGACP00000000563 69293.ENSGACP00000001636 69293.ENSGACP00000001651 69293.ENSGACP00000002305 69293.ENSGACP00000002675 69293.ENSGACP00000003705 69293.ENSGACP00000018383 69293.ENSGACP00000019640 69293.ENSGACP00000023824 7955.ENSDARP00000067896 7955.ENSDARP00000093781 7955.ENSDARP00000093790 7955.ENSDARP00000099321 7955.ENSDARP00000099947 7955.ENSDARP00000101522 XP_008303999.1.38333 XP_009296488.1.45394 XP_009301184.1.45394 XP_010787183.1.77114 XP_011609509.1.43653 XP_017212659.1.45394 XP_017212660.1.45394 XP_018923860.1.5815 XP_018923914.1.5815 XP_018940060.1.5815 XP_018958610.1.5815 XP_018961809.1.5815 XP_018964605.1.5815 XP_018965883.1.5815 XP_019722190.1.30352 XP_019742648.1.30352 XP_019742649.1.30352 XP_020511991.1.8198 XP_020511993.1.8198 XP_020516488.1.8198 ENSGACP00000000564 ENSGACP00000001637 ENSGACP00000001652 ENSGACP00000002306 ENSGACP00000002677 ENSGACP00000003706 ENSGACP00000018384 ENSGACP00000019641 ENSGACP00000023825 ENSGACP00000000563 ENSGACP00000001636 ENSGACP00000001651 ENSGACP00000002305 ENSGACP00000002675 ENSGACP00000003705 ENSGACP00000018383 ENSGACP00000019640 ENSGACP00000023824 ENSDARP00000067896 ENSDARP00000093781 ENSDARP00000093790 ENSDARP00000099321 ENSDARP00000105220 ENSDARP00000107737 ENSDARP00000111851 gi|170287757|gb|AAI60940|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]