SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000105266 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000105266
Domain Number - Region: 22-156
Classification Level Classification E-value
Superfamily Macro domain-like 0.0171
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000105266   Gene: ENSDARG00000086217   Transcript: ENSDART00000131135
Sequence length 165
Comment pep:known chromosome:Zv9:8:43267400:43275042:-1 gene:ENSDARG00000086217 transcript:ENSDART00000131135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFYFCRARGDGRMSVRIQPIQFTTDCKDQNFDGIILITQNYEQLPNELECLKAPLQDYSA
VDCCIKDEVVVLRVPGLPGNRLVCSCTGPVNRDYDDVRRFRDAAANGIKRALKAGLQRPL
LVCPPNSSYAKNTLVAVLGALHVLYVPLEVREHKSSPHKVATLGL
Download sequence
Identical sequences ENSDARP00000105266 ENSDARP00000105266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]