SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000105290 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000105290
Domain Number 1 Region: 4-124
Classification Level Classification E-value
Superfamily Histone-fold 4.34e-48
Family Nucleosome core histones 0.0000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000105290   Gene: ENSDARG00000091051   Transcript: ENSDART00000129403
Sequence length 128
Comment pep:known chromosome:Zv9:7:7264952:7265338:-1 gene:ENSDARG00000091051 transcript:ENSDART00000129403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TEKATKGK
Download sequence
Identical sequences E7F5W3
7955.ENSDARP00000098527 ENSDARP00000090632 ENSDARP00000105290 ENSDARP00000090632 ENSDARP00000105290 XP_009296461.1.45394 XP_693579.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]