SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000106781 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000106781
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily Histone-fold 9.35e-59
Family Nucleosome core histones 0.00000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000106781   Gene: ENSDARG00000088259   Transcript: ENSDART00000122306
Sequence length 132
Comment pep:known chromosome:Zv9:7:7240069:7240994:1 gene:ENSDARG00000088259 transcript:ENSDART00000122306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPAKTAPKKGSKKAVTKTAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSKFSNQNITY
Download sequence
Identical sequences ENSDARP00000106781 ENSDARP00000106781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]