SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000107084 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000107084
Domain Number 1 Region: 103-521
Classification Level Classification E-value
Superfamily Ras GEF 2.62e-103
Family Ras GEF 0.00016
Further Details:      
 
Domain Number 2 Region: 621-710
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.84e-31
Family Ras-binding domain, RBD 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000107084   Gene: ENSDARG00000007727   Transcript: ENSDART00000130425
Sequence length 744
Comment pep:known chromosome:Zv9:16:48428576:48480573:-1 gene:ENSDARG00000007727 transcript:ENSDART00000130425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPRSMKSSGVDLPGVGPREVPLIGYRALQTELDGSPDQLWKESEHREADHHTQGEPSPM
KTTWYCPLDLSTVSEMEEDGIIYTVVVKQGPGSPTSPQSTAARSQHVKAGTEEKLVLHLL
HSFSMGDSSFISIFLSTYRSFTSTQRVLDILICRLENPPGESHSNSRQMFNKAVCTVFST
WMTDYPEDFRSLSDPSRLLRLAPLLPTDSSGAEIKSRLLRIAEELSEKTLLSASLSDPTK
GLLSPPNPSDFDATSVLGFPSSVIAEQLTRIETDLFLKLVPHHCLGSLWSQRDKKGQEGA
CWSVRATIKQFNRLANAVTASCLWMTTLKSQQRARLLEKWISVAEACRTRKNFSSLYAIL
SALQSNPIHRLRKTWQETDREAVKRYEELSDIFSEKDNYSQSRELLKEEGTSKFANHDTK
INNRRFTGSCAQGTVPYLGIFLRDLTMLDTAVKDRLENGFINFDKRRREFEVIAQIRLLQ
SSCKNSIFRTDETFIHWYHSVPTLREEESYKLSNQIEAPGEPSPGRGLNPTVIITQCPDA
LSAVANTTMDADGIFDFPSPVNQLLSKLCKHVKSPSVSCLDVDSSPPSNDSTPSILTTPT
TAVKSHRRSVSCGNNPTNSKPEAGPDMRIVRIRMDLHDGNLYRSILVTSNDKTPTVISSA
LEKHNQNAQEASKYELIQLLPEGKELIIPPTGNVFYAMSSASVDFLLRRRGGNTPTGSPN
LGNETSATFPRIKAKGRRLVRTLF
Download sequence
Identical sequences F1R6X8
ENSDARP00000107084 XP_005158441.1.45394 XP_017206850.1.45394 ENSDARP00000107084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]