SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000107232 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000107232
Domain Number 1 Region: 5-106
Classification Level Classification E-value
Superfamily Histone-fold 1.8e-48
Family Nucleosome core histones 0.00000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000107232   Gene: ENSDARG00000087451   Transcript: ENSDART00000126546
Sequence length 138
Comment pep:known chromosome:Zv9:7:7268889:7269678:-1 gene:ENSDARG00000087451 transcript:ENSDART00000126546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESSISTKMSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLA
AVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQ
AVLLPKKTEKAAKKINGK
Download sequence
Identical sequences ENSDARP00000107232 ENSDARP00000107232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]