SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000107702 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000107702
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily Histone-fold 1.77e-58
Family Nucleosome core histones 0.00000269
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000107702   Gene: ENSDARG00000051726   Transcript: ENSDART00000128017
Sequence length 124
Comment pep:known chromosome:Zv9:25:36172866:36173240:-1 gene:ENSDARG00000051726 transcript:ENSDART00000128017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPAKTAPKKGSKKAVTKTAGKSGKKRRRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
Download sequence
Identical sequences F1R4A4
ENSDARP00000107702 XP_005163255.1.45394 XP_017209640.1.45394 ENSDARP00000107702 ENSDARP00000126636 ENSDARP00000128743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]