SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000108465 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000108465
Domain Number 1 Region: 6-127
Classification Level Classification E-value
Superfamily Histone-fold 2.99e-48
Family Nucleosome core histones 0.0000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000108465   Gene: ENSDARG00000086591   Transcript: ENSDART00000124306
Sequence length 130
Comment pep:known chromosome:Zv9:25:37359018:37359410:1 gene:ENSDARG00000086591 transcript:ENSDART00000124306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HNMSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAQRVGAGAPVYLAAVLEY
LTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLP
KKTEKAAKGK
Download sequence
Identical sequences ENSDARP00000108465 ENSDARP00000108465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]