SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000108779 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000108779
Domain Number 1 Region: 30-303
Classification Level Classification E-value
Superfamily Ras GEF 1.19e-76
Family Ras GEF 0.0000538
Further Details:      
 
Domain Number 2 Region: 469-586
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000132
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000108779   Gene: ENSDARG00000026519   Transcript: ENSDART00000127622
Sequence length 594
Comment pep:known chromosome:Zv9:20:15973494:16119229:-1 gene:ENSDARG00000026519 transcript:ENSDART00000127622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDGLLNMDVPNGQPSVSTLTAPASERSSSSESLSEKGTSELKSFDAVVFDVLKVTPEE
YAGQITLMDAPVFRAIQPEELSSCGWNKKEKHSSAPNAVAFTRRFNQVSFWVVREILHAQ
TLKIRAEVLSLYIRTAKKLCDMNSLHAVMAVVSALQSAPIFRLTKTWALLSRKDKATFER
LEYLMSKEDNYKRLRDYISSQSMTSCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLM
NNILRIISDLQRSCEYEIPVLPHVQKYLNSVRYIEELQKFVEDDNYKLSLKIEPPATSTP
RTTASREDLTGPDISASPLCGRHGNVAEGALPKVPPTPPSPRNLITYGHRKCHSLGYNFI
HKTNTVEFKSATFPNAGSRHLLDDSVLESHTPTRGHAESSTLSSGISLGSSEGSELSEEM
SWPAFERTRFYHSLGPVTRVGRMSCRGSLRPSSSAESEELAVHLYPGAVTVQGVLRRKTV
LKEGKKPTVAAWTKYWVALCGTQLYYYTAKSLKATERKHFKSTASKTVCVLGLMAMMADD
PEHPDVFLLTDSEHGNSYKFQAGNRMNALLWFKHLSAACQSNRQQVPANLMSFE
Download sequence
Identical sequences ENSDARP00000108779 ENSDARP00000108779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]