SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000108828 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000108828
Domain Number 1 Region: 6-107
Classification Level Classification E-value
Superfamily Histone-fold 2.1e-48
Family Nucleosome core histones 0.00000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000108828   Gene: ENSDARG00000088291   Transcript: ENSDART00000123660
Sequence length 135
Comment pep:known chromosome:Zv9:7:7291735:7292142:-1 gene:ENSDARG00000088291 transcript:ENSDART00000123660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKNCSLIKMSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYL
AAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNI
QAVLLPKKTEKAAKK
Download sequence
Identical sequences ENSDARP00000108828 ENSDARP00000108828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]