SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000108950 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000108950
Domain Number 1 Region: 45-221
Classification Level Classification E-value
Superfamily Ras GEF 7.19e-29
Family Ras GEF 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000108950   Gene: ENSDARG00000090443   Transcript: ENSDART00000131192
Sequence length 222
Comment pep:known chromosome:Zv9:21:152760:160781:-1 gene:ENSDARG00000090443 transcript:ENSDART00000131192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKMMMLETQNASQEIGEEVEEGAVFSITVRKVQVYQSSSSRGQQQHSDSHTCKLRSIKAG
TLERLVENMLTAFRGNDSTYVTIFLCTYRTFATTKQVLDLLLNRYAKLQQQPGPDVRRMT
SDERTELRNTISSILGAWLDQYSEDFWKPPEYSCLRRLILYLQINFPGSDLERRACNLLS
HFHRRLQHAEPDLLEQGCCAFSLLEENGFEEERPDFLSFDPT
Download sequence
Identical sequences ENSDARP00000108950 ENSDARP00000108950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]