SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000109315 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000109315
Domain Number 1 Region: 6-123
Classification Level Classification E-value
Superfamily Histone-fold 5e-58
Family Nucleosome core histones 0.00000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000109315   Gene: ENSDARG00000089719   Transcript: ENSDART00000122864
Sequence length 133
Comment pep:known chromosome:Zv9:25:36115022:36115619:1 gene:ENSDARG00000089719 transcript:ENSDART00000122864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPAKPAPKKGSKKAVSKTAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSNIYKNQSLSP
Download sequence
Identical sequences ENSDARP00000109315 ENSDARP00000109315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]