SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000109381 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000109381
Domain Number 1 Region: 103-420,448-552
Classification Level Classification E-value
Superfamily Ras GEF 1.57e-100
Family Ras GEF 0.00054
Further Details:      
 
Domain Number 2 Region: 666-760
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.68e-38
Family Ras-binding domain, RBD 0.0000486
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000109381   Gene: ENSDARG00000071213   Transcript: ENSDART00000122796
Sequence length 782
Comment pep:known chromosome:Zv9:6:9554166:9586085:1 gene:ENSDARG00000071213 transcript:ENSDART00000122796 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSCLLVSGGEKGLRARLGRMRQLLCQTDHVEIQVDEEPGVWLRSFHLLDLQEHTEDPVQ
EWGEEVEDGAIYGVTLHREPIQPPPDASESDAAFGFMQYRTLKVRRLKAATLDRLVTELV
NPECPDPDYMHIFLSTYRAFTCTNALIELLFQREDMVTNLNNSVCVKSSLPRLIRLWLDE
FHEDLRDSPDHQALRLLCVHLRHRLCCRRLVNQADALLRKFQTEDKQICTSAEVNASAVE
NPATEDNLDGQEVQEIGDVLDFPAQDIAEQLTILDAELFSKVVPFHCLGCIWSQRDKKEN
QNLVSTVRATIAQFNVVTNCVITSLLCPPATSPPGSPSCHRSSPTYRAKIIEKWISVAQE
CHQLRNFSSLRAILSALQSNAVYRLKKTWAVISRESMAVFEHLCDTFPDENCVLINREIL
VEEGNQAADVETHSAPKSPRLSPTCKHMSSSSGEVPYLGTYLTVLTMLDTALTDNVEGGL
INFEKRRKEFEILSLIRQLQASCAHYTLQSHPRIISWINSSMSLSDQKSYELSRELEPPV
DPCPSSPNSWSHRLIAKKLNLLLSATENFSRKTLADQISVSSSGSSGSDMEDLGRDLSSP
NTSPLVYKSPSVSCQDISVDTPTSSPTPPPSCQRSLQADLPESPSSTSSSSSSSSPSLHQ
RCALHPMYNKQVADSCIVRVSVEFGNNGNVYKSILITSQDKTAQVVQRALEKHNLEEMNC
QDFTLTQVLSNDKELLIPDKANVFYAMCTTANYDFVLRQRYKHLSRATGPSWSPGAVVRS
RK
Download sequence
Identical sequences I3IT01
XP_009300441.1.45394 ENSDARP00000109381 ENSDARP00000109381 ENSDARP00000126052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]