SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000109715 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000109715
Domain Number 1 Region: 476-675,703-727
Classification Level Classification E-value
Superfamily Ras GEF 1.29e-35
Family Ras GEF 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000109715
Domain Number - Region: 815-857,889-965
Classification Level Classification E-value
Superfamily PH domain-like 0.000135
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000109715   Gene: ENSDARG00000089601   Transcript: ENSDART00000125067
Sequence length 1193
Comment pep:known chromosome:Zv9:12:5497166:5606348:-1 gene:ENSDARG00000089601 transcript:ENSDART00000125067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLHVERQAHIGIKSSMASNRASPVLGVKSLGKETSSNGDARLLMNYSLPGGTPPQTPVH
LEGDSVGTVCRIWKSLDIRSKSLDCLDETFRSKNCSCEAIRHREEGSYNFHMCGFCDSVE
NAEGCPKNTFSPRSWGTVPQKRKAEAFSSGITSLDEPRPTLSGSDGELCPKELVISQNME
NLPFCGLDLRRSSVPVSTPQGPQCANGCGTAENNKMRNRLDFLCAVCHKNGFSSLERLNR
NTKPMCSKGKPLKRSKPFRFSVPDSSDGEGTVSDSEFVRNRKDRSTVLVRRYLKNNQKFK
KTVCTGTKAIVKTLPTGCISDRIWESVCNERSRHEASGHSKALQAIQLQVSRALLAYPGA
RLAEIDHAAPTLSPEVSLLHRSRKLLAQAVSWPPVSPSQIRFRACHRRISIAAHLSGALL
EATAALGARTSLPSFTVGSTGRAMLKERQLCSSMANSSILPSAVTGISKELADLRHLIQF
PEEIATILTEQEQQLYRRVFPLDYLSFLTRDLGSPECHKRHPHLKASLSAPIMPTQNDNH
NTVEDLVTRFNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCSWNMGNYNAVMEFLAGL
RSRKVLKMWQFMDQADIETMRGLKDAMAQHESSSEYKKVVSRALNIPGCKVVPFCGVFLK
ELSEALDGAASIIGLRPSFDSQEDPVEFVTDYNGQQHFLQRLGSDGLHSSDKEATVSNIL
QTIRSCNRSLEAEEPEERAREITVCPKNSFKDKSRNQKGPGTERVLFSIGDLSDSEGDPL
ETVKDVVDLQTTEDVRGPFSHGTELIPWYVLSLQPDIHQFLLQGATVIHYDPESHLTARC
LLRLQPDNCFLTWCKPHSSCSLYGRARTFMGHPASPDHLHIGQPVHCGLSDGLLDLNVVK
AVFMGHPGVDVNYVCLQHKLCNMNPGENGVTLLYGLHTTDNRLLHFVAPKHTARMLHEGL
QELLNSIRKIRKFPDQRLQWLRKQYVSLYQEDGRFEGPTLAHAIELFGGRRWNMGTSGPG
SASRGAEKNSAQKNSPLGINSNVKKKKKALVRGDSGDGTDDEMTARKTRSCKETLGRRES
DALENVEQEEAEDCSTFSQPGPFSLSNNKGQSPGSSSSSSTSSSVASFCTNSSTPTRPHS
SPILPTNLKSQPGAWSSRSWHGRGKGCFRGFQDLMISDSIMSFVEFVELFKSF
Download sequence
Identical sequences ENSDARP00000109715 ENSDARP00000109715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]