SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110511 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110511
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily Histone-fold 8.06e-59
Family Nucleosome core histones 0.00000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110511   Gene: ENSDARG00000091066   Transcript: ENSDART00000124016
Sequence length 124
Comment pep:known chromosome:Zv9:7:76859940:76860314:1 gene:ENSDARG00000091066 transcript:ENSDART00000124016 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPAKAAPKKGSKKAVTKTAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
Download sequence
Identical sequences A7MCA7 Q5BJA5
ENSDARP00000101525 ENSDARP00000105746 ENSDARP00000110511 ENSDARP00000111973 ENSDARP00000127042 ENSDARP00000101525 ENSDARP00000105746 ENSDARP00000110511 ENSDARP00000111973 7955.ENSDARP00000050236 7955.ENSDARP00000053612 7955.ENSDARP00000088585 7955.ENSDARP00000093801 7955.ENSDARP00000099813 7955.ENSDARP00000101154 7955.ENSDARP00000101525 7955.ENSDARP00000103151 XP_002666990.1.45394 XP_005163256.1.45394 XP_005170789.1.45394 XP_005172456.1.45394 XP_009301957.1.45394 XP_017209639.1.45394 XP_017212661.1.45394 gi|163916545|gb|AAI57572| gi|166158047|ref|NP_001107432|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]