SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000111194 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000111194
Domain Number 1 Region: 7-123
Classification Level Classification E-value
Superfamily Histone-fold 2.1e-58
Family Nucleosome core histones 0.00000307
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000111194   Gene: ENSDARG00000091728   Transcript: ENSDART00000126590
Sequence length 133
Comment pep:known chromosome:Zv9:25:36105568:36106017:-1 gene:ENSDARG00000091728 transcript:ENSDART00000126590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPAKAAPKKGSKKAVTKTAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSNNVILKRVSV
Download sequence
Identical sequences ENSDARP00000111194 ENSDARP00000111194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]