SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000111298 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000111298
Domain Number 1 Region: 7-124
Classification Level Classification E-value
Superfamily Histone-fold 7.42e-59
Family Nucleosome core histones 0.00000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000111298   Gene: ENSDARG00000088028   Transcript: ENSDART00000121649
Sequence length 124
Comment pep:known chromosome:Zv9:7:7245935:7246309:1 gene:ENSDARG00000088028 transcript:ENSDART00000121649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPAKTAPKKGSKKAVTKTAGKGGKKRKRTRKESYAIYVYKVLKQVHPDTGISSKAMGI
MNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKY
TSSK
Download sequence
Identical sequences Q05AK8
7955.ENSDARP00000097953 7955.ENSDARP00000097981 7955.ENSDARP00000101135 7955.ENSDARP00000102101 7955.ENSDARP00000102775 ENSDARP00000102775 ENSDARP00000111298 ENSDARP00000121459 ENSDARP00000128269 XP_001335214.1.45394 XP_002667787.1.45394 XP_003198935.1.45394 XP_005168860.1.45394 XP_005170787.1.45394 XP_009301169.1.45394 XP_009301182.1.45394 XP_017212444.1.45394 XP_021333351.1.45394 XP_692972.1.45394 ENSDARP00000102775 ENSDARP00000111298 ENSDARP00000121459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]