SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000114027 from Danio rerio 69_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000114027
Domain Number 1 Region: 460-662,714-970
Classification Level Classification E-value
Superfamily Ras GEF 3.01e-112
Family Ras GEF 0.00014
Further Details:      
 
Domain Number 2 Region: 203-341
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.96e-43
Family DEP domain 0.000000541
Further Details:      
 
Domain Number 3 Region: 23-160
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.13e-26
Family cAMP-binding domain 0.000000592
Further Details:      
 
Domain Number 4 Region: 334-463
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.27e-25
Family cAMP-binding domain 0.000000964
Further Details:      
 
Domain Number 5 Region: 679-723
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000413
Family Ras-binding domain, RBD 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000114027   Gene: ENSDARG00000079872   Transcript: ENSDART00000144046
Sequence length 972
Comment pep:novel chromosome:Zv9:9:2947780:3032633:-1 gene:ENSDARG00000079872 transcript:ENSDART00000144046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISPKMVAAHTSSHPSASADWIVCLDKRPEERSGEDVDIIMVRLKSVKAFEKFHPPLLQQ
ICLCGFYECLEKGITLYRQGDIGTNWYTVLSGSLDVKVSETANHQDAVTICTLGIGTAFG
ESILDNTPRHATIVTREFSELLRIEQKDFRNLWENYRQCMAGLLVPPYGVMDSGPNADRM
PDKENLSNSSPGLSPKHLNKVPSEKILRAGKVLRNIILSRAPHMIRDRKYHLKTYRRSCI
GTELVDWLLQHTSCVHSRVQAVGMWQVLLEEGVLNHVDQEPTFQDKYLFYRFLDDESEDS
GMPSEEDKKESDEELQDTLLLLSQIGPDAHLRMILRKQPGQRTVDDLEIIYEELLHIKAL
SHLSTTVKRELAGVLIFESHAKAGTVLFNQGEEGTSWYIILKGSVNVVIYGKGVVCTLHE
GDDFGKLALVNDAPRAASIVLREDFCHFLRVDKEDFNRILRDVEANTVRLKEHEEDVLVL
EKANNRSSSSSPLKYTVMSGTPEKILEHLLETMKLDCQFSESDPALDDFLLMHCVFVPNS
QLCPLLMTQYPSLIKPYCFSTKTPHQASQGSEQERMDYTLNNKRRVVRLVLQWASINTDH
LQEEDSSFSFIQEFYEMVCEDSRLTPALKDHLPELEKIIKQNSDDGRPSQKKHKVLLRQF
STGNDRLQKRQPIKSTDENKELLKPSDVSIFSSLSINGRLFVCPRDQIDSLTPLPEQEGP
SAGSMSTFELMSSKDLAHQMTLYDWELFHCVHEHELIYHTFGRHHFKKTTANLDLFLRRF
NEVQLWVVTEVCLCPALSKRVQLLKKFIKIAAHCKEFKNLNSFFAIIMGLGNPAVCRLSQ
TWEKLPSKFKKFYGEFENLMDPSRNHRAYRLTMAKLEPPIIPFMPLLIKDMTFTHEGNKT
FTDRLVNFEKMRMIANTVRIIRYCRSQPFDQEAPQATGKSHQDVRTYVRHISVIDNQRSL
SQLSHRLEPRRT
Download sequence
Identical sequences B0S4Y8
ENSDARP00000114027 ENSDARP00000114027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]